This is a working overview of redox status, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2025-09-07. Anything still debated is marked as such rather than presented as settled.
Commercial glutathione is available in research-grade, food-grade, and supplement-grade forms, and purity specifications differ accordingly. Certificates of analysis commonly report identity by nuclear magnetic resonance or mass spectrometry, purity by HPLC, residual solvents, and heavy metals. Reference standards with assigned purity support calibration, while isotopically labeled glutathione can serve as an internal standard for mass spectrometry. For supplements, label claims may not be independently verified, and regulatory oversight varies by country. Verification often involves third-party testing for identity, potency, and contaminants.
Quantifying glutathione requires distinguishing GSH from GSSG and preventing oxidation during sample preparation. Common approaches include the enzymatic recycling assay, often called the Tietze method, which measures total glutathione after converting GSSG to GSH. HPLC with ultraviolet or fluorescence detection and LC-MS/MS can separate and quantify both forms, sometimes after derivatization of the thiol group. Blood, plasma, and tissue samples differ in matrix and baseline concentrations, so method validation must account for recovery, linearity, and interference. No single assay is universally standard.
Storage recommendations for glutathione reagents usually specify a cool, dry, dark environment because the thiol oxidizes in air and light. Solid material is often kept desiccated at low temperature, while solutions are prepared fresh or stored frozen in aliquots. Repeated freeze-thaw cycles can accelerate degradation, and metal ions can catalyze oxidation. Quality control may include purity assays, water content, and identity confirmation. Stability limits are method-specific, so a stated shelf life applies only to defined conditions and packaging.
Laboratory measurement of glutathione requires attention to oxidation before analysis. Blood, tissue, or cell samples can lose reduced glutathione as it converts to GSSG or forms mixed disulfides with proteins. Acid extraction, rapid freezing, and thiol-blocking reagents are common strategies to preserve the original distribution. Reported concentrations therefore depend on collection protocol, extraction method, and the time between sampling and analysis. Comparisons across studies are most reliable when these pre-analytical variables are described.
| Property | Value | Notes |
|---|---|---|
| Typical assay | Enzymatic recycling assay (Tietze) | Measures total glutathione after reduction of GSSG. |
| Separation method | HPLC or LC-MS/MS | Can quantify GSH and GSSG separately with appropriate standards. |
| Solid storage | -20 °C, desiccated, protect from light | Dry powder is more stable than aqueous solutions. |
| Solution storage | Acidic pH, -80 °C, aliquot | Reduce oxygen exposure and freeze-thaw cycling. |
| Oxidation product | Glutathione disulfide (GSSG) | Formed by thiol oxidation; often measured as a stress marker. |
Stability depends on pH, temperature, oxygen exposure, and trace metals. Aqueous solutions of reduced glutathione are susceptible to oxidation, especially when neutral or alkaline and exposed to air. Transition metal ions can catalyze thiol oxidation, so chelators and inert atmospheres are sometimes used in research settings. Standards are typically stored cold and desiccated, with limited freeze-thaw cycles. Questions remain about how closely in vitro stability data reflect the behavior of glutathione within intact cells and tissues.
Measuring glutathione requires attention to oxidation during sample handling, because GSH in biological samples can convert to GSSG or form mixed disulfides with proteins after collection. Acidic extraction, rapid cooling, and chelating agents are commonly used to limit such changes. Analytical methods usually distinguish free reduced glutathione, total glutathione, and protein-bound forms. Because these forms have different stability and reactivity, reported values depend heavily on the preparation protocol. No single preparation is universally suitable for every biological matrix or analytical goal.
Several techniques are used for quantification. Enzymatic recycling assays rely on glutathione reductase and a colorimetric or fluorescent readout, offering sensitivity for total glutathione. High-performance liquid chromatography can separate GSH from GSSG and other thiols, often with UV, fluorescence, or electrochemical detection. Mass spectrometry provides structural confirmation and can quantify low-abundance species when paired with separation. Each approach has trade-offs in specificity, throughput, and equipment requirements, so method selection depends on the research question and available instrumentation.
Enzymatic recycling assays provide a complementary approach for total glutathione. In these methods, glutathione reductase reduces oxidized glutathione while a thiol-reactive reagent, such as 5,5'-dithiobis(2-nitrobenzoic acid), produces a colored product. The reaction cycles between reduced and oxidized forms, amplifying the signal. Spectrophotometric or fluorometric detection can then estimate concentration. Distinguishing reduced glutathione from glutathione disulfide often requires separate aliquots, masking agents, or chromatographic separation, and the choice affects reported values.
Storage conditions strongly influence glutathione stability. The solid reduced form is commonly kept desiccated at or below minus twenty degrees Celsius, protected from light and moisture. Aqueous solutions are less stable because the thiol group reacts with dissolved oxygen, and oxidation accelerates at neutral or alkaline pH. Acidic solutions and oxygen-free handling can slow degradation, but repeated freeze-thaw cycles should be avoided. Researchers often verify concentration before use, because apparent losses can arise from oxidation or water uptake.
Measuring glutathione in biological samples requires attention to oxidation and matrix effects. High-performance liquid chromatography with ultraviolet or fluorescence detection can separate reduced and oxidized forms after derivatization. Liquid chromatography with tandem mass spectrometry offers higher specificity and can quantify glutathione alongside related thiols. Because glutathione can oxidize during sample handling, many protocols use rapid acidification with metaphosphoric acid or sulfosalicylic acid. Internal standards help correct for losses during extraction and analysis.
Measuring glutathione in biological samples requires attention to oxidation, because GSH can convert to GSSG after sample collection. Blood and plasma samples are often treated with acid or alkylating agents to preserve the reduced form. Without stabilization, apparent GSH concentrations can fall while GSSG rises. Differences in sample type, handling delay, and deproteinization method can produce results that are not comparable across studies. Reporting preanalytical details is therefore important for interpreting findings.
Common analytical approaches include enzymatic recycling assays, high-performance liquid chromatography, and mass spectrometry. Enzymatic recycling measures total glutathione after converting GSSG back to GSH, while separation methods can quantify GSH and GSSG separately. Derivatization may be used to improve detection or stability during analysis. LC-MS/MS offers high specificity and can distinguish glutathione from related thiols and adducts. Each method has different sensitivity, throughput, and susceptibility to interference, so method selection depends on the study question and sample matrix.
Glutathione is a tripeptide composed of glutamate, cysteine, and glycine, and it is the most abundant non-protein thiol in most living cells. The reduced form, GSH, carries a sulfhydryl group that can donate electrons, while the oxidized form, GSSG, forms when two GSH molecules link via a disulfide bond. The balance between these two forms helps define the cellular redox environment, and their ratio is often used as an indicator of oxidative stress. Because the sulfhydryl group is reactive, glutathione participates in many cellular processes, including detoxification and protein regulation.
Glutathione is synthesized in two ATP-dependent steps. First, gamma-glutamylcysteine synthetase links glutamate and cysteine; second, glutathione synthetase adds glycine to form the complete tripeptide. The pathway is feedback-inhibited by GSH itself, which helps maintain steady intracellular levels. Tissues vary widely in glutathione content, with the liver typically containing the highest concentrations, followed by the kidneys, lungs, and erythrocytes. Because cysteine is often limiting, its availability influences synthesis rates, and regulation of this pathway varies by cell type.
Glutathione serves as a cofactor for several enzymes, including glutathione peroxidase and glutathione S-transferase. These enzymes help reduce hydrogen peroxide and lipid peroxides, and they conjugate reactive electrophiles for excretion. The molecule also acts as a reservoir for cysteine, an amino acid that is prone to oxidation. In addition, glutathione participates in the metabolism of nitric oxide, leukotrienes, and prostaglandins. Its roles extend to cell signaling, apoptosis, and the regulation of protein function through S-glutathionylation.
== Bibliography == Wink, M (2009). "Mode of action and toxicology of plant toxins and poisonous plants". Mitt. Julius Kühn-Inst. 421: 93–112. Archived from the original on 18 March 2014. Retrieved 18 March 2014.
A ball check valve is a check valve in which the closing member, the movable part to block the flow, is a ball. In some ball check valves, the ball is spring-loaded to help keep it shut. For those designs without a spring, reverse flow is required to move the ball toward the seat and create a seal. The interior surface of the main seats of ball check valves are more or less conically tapered to guide the ball into the seat and form a positive seal when stopping reverse flow. Ball check valves are often very small, simple, and cheap. They are commonly used in liquid or gel minipump dispenser spigots, spray devices, some rubber bulbs for pumping air, etc., manual air pumps and some other pumps, and refillable dispensing syringes. Although the balls are most often made of metal, they can be made of other materials; in some specialized cases out of highly durable or inert materials, such as sapphire. High-performance liquid chromatography pumps and similar high pressure applications commonly use small inlet and outlet ball check valves with balls of (artificial) ruby and seats made of sapphire or both ball and seat of ruby, for both hardness and chemical resistance. After prolonged use, such check valves can eventually wear out or the seat can develop a crack, requiring replacement. Therefore, such valves are made to be replaceable, sometimes placed in a small plastic body tightly fitted inside a metal fitting which can withstand high pressure and which is screwed into the pump head.
== Synthesis == ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
== Non-medical uses == Metandienone is used for physique- and performance-enhancing purposes by competitive athletes, bodybuilders, and powerlifters. It is said to be the most widely used AAS for such purposes both today and historically.
In July 2020, his series Die Hart premiered on Quibi on July 20 and had a strong first weekend. In March 2023, Roku and Hart's multi-platform comedy brand Laugh Out Loud debuted the series' second season on The Roku Channel. In addition to returning to his starring role, Hart executive produced the second season; Laugh Out Loud CEO and Hart's longtime business partner, Jeff Clanagan, served as a producer on the project. Hart signed a first look deal with Netflix in January 2021. He later played Arnold Drummond in the Diff'rent Strokes portion of the third edition of Live in Front of a Studio Audience. In 2022, Hart starred alongside Mark Wahlberg in the comedy film, Me Time. The film shows how Sonny (Hart) experiences a wild journey with his friend after finding a much-longed-for free weekend. In January 2024, Hart starred (alongside Úrsula Corberó from Money Heist and Vincent D'Onofrio) as a master thief in the Netflix comedy heist film Lift, directed by F. Gary Gray. A month later, he competed in season eleven of The Masked Singer as "Book". He purposely unmasked himself in the season eleven premiere as part of a prank on host Nick Cannon.
Sources: en.wikipedia.org
==== Cross-linking ==== Corneal collagen cross-linking is a developing treatment that aims to strengthen the cornea, however, according to a 2015 Cochrane review, there is insufficient evidence to determine if it is useful in keratoconus. In 2016, however, the FDA approved cross-linking surgery as a treatment for keratoconus and recommended that a registry system should be set-up to evaluate the long-term treatment effect. The Save Sight Keratoconus Registry is an international database of keratoconus patients that is tracking outcomes of cross-linking in patients with keratoconus.
== Pathophysiology == Following a meal, glucose concentration in the bloodstream rises, providing a stimulus for insulin secretion. Autoantibodies bind to these insulin molecules, rendering them unable to exert their effects. The resultant hyperglycemia promotes further insulin release. As glucose concentration eventually falls, insulin secretion also subsides, and the total insulin level decreases. Now insulin molecules spontaneously dissociate from the autoantibodies, giving rise to a raised free insulin level inappropriate for the glucose concentration, causing hypoglycemia.
== Neurogenesis == Laboratory studies indicate that BDNF may play a role in neurogenesis. BDNF can promote protective pathways and inhibit damaging pathways in the NSCs and NPCs that contribute to the brain's neurogenic response by enhancing cell survival. This becomes especially evident following suppression of TrkB activity. TrkB inhibition results in a 2–3 fold increase in cortical precursors displaying EGFP-positive condensed apoptotic nuclei and a 2–4 fold increase in cortical precursors that stained immunopositive for cleaved caspase-3. BDNF can also promote NSC and NPC proliferation through Akt activation and PTEN inactivation. Some studies suggest that BDNF may promote neuronal differentiation.
=== Agonists === Non-selective α-MSH β-MSH γ-MSH Afamelanotide Bremelanotide Melanotan II Modimelanotide Setmelanotide MC1-selective BMS-470,539 MC4-selective PF-00446687 PL-6983 THIQ Unknown (but for certain MC2-acting) Alsactide Tetracosactide
perché alla terra alfin torna repente / precipitevolissimevolmente The word technically violates Italian grammar rules, the correct form being precipitevolissimamente, which is three letters and one syllable shorter. The poet coined the new word to have 11 syllables in the second verse. Other words can be created with a similar (and grammatically correct) mechanism starting from a longer root, winding up with a longer word. Some examples are:
Sources: en.wikipedia.org
The German Islands of Sylt, Föhr, Pellworm, Amrum, Heligoland and Fehmarn are part of Schleswig-Holstein, with the latter being the largest and the only Island of Schleswig-Holstein located on the east coast. Heligoland is Germany's only high-sea island.
In August 2006, the court accepted the settlement between RTM and Access Now. The result was that every year, 100 of the RTM stores would be retrofitted to comply with the ADA. Accordingly, it was estimated that about $1.2 million would be spent to retrofit those stores each year. In 2008, Triarc purchased Wendy's, and changed its name to Wendy's/Arby's Group, to reflect their core businesses. In January 2011, it was announced that Wendy's/Arby's Group was looking into selling the Arby's side of the business to focus on the Wendy's brand. It was officially announced the companies would split on January 21, 2011. In 2009, the Wendy's/Arby's Group signed a franchise deal with the Al Jammaz Group of Saudi Arabia to open dual-branded Wendy's/Arby's through the Middle East with the first location opening in Dubai in the United Arab Emirates in May 2010. The Wendy's/Arby's Group also signed a similar franchise deal in June 2010 with Tab Gida Sanayi ve Ticaret to open dual-branded restaurants in Turkey. After the split, the former Wendy's/Arby's Group became The Wendy's Company.
Over-the-counter preparations containing dextromethorphan have been used in manners inconsistent with their labeling, often as a recreational drug. At doses much higher than medically recommended, dextromethorphan and its major metabolite dextrorphan act as NMDA receptor antagonists, producing dissociative hallucinogenic states somewhat similar to those of ketamine and phencyclidine. It may produce distortions of the visual field, feelings of dissociation, distorted bodily perception, excitement, and a loss of sense of time. Some users report stimulant-like euphoria, particularly in response to music. Dextromethorphan usually provides its recreational effects in a non-linear fashion, so that they are experienced in significantly varied stages. These stages are commonly referred to as "plateaus". These plateaus are numbered from one to four, with the first having the mildest effects to fourth being the most intense. Each plateau is said to come with different related effects and experiences. The first plateau is said to induce music euphoria and mild stimulation, likened to that of MDMA. The second plateau is likened to a state of being on moderate amounts of alcohol and cannabis at the same time, featuring euphoria, sedation and minor hallucinations. The third plateau induces a significant dissociative state which can often cause anxiety in users. Reaching the fourth plateau is said to cause extreme sedation and a significant hallucinatory state as well as complete dissociation from reality.
==== The Convicts of the Road ==== In 1924, a journalist Albert Londres followed the Tour de France for the French newspaper Le Petit Parisien. At Coutances he heard that the previous year's winner, Henri Pélissier, his brother Francis and a third rider, Maurice Ville, had resigned from the competition after an argument with the organiser Henri Desgrange. Pélissier explained the problem—whether or not he had the right to take off a jersey—and went on to talk of drugs, reported in Londres' race diary, in which he invented the phrase Les Forçats de la Route (The Convicts of the Road):
Sources: en.wikipedia.org
The ratio depends on rapid separation or blocking of GSH before oxidation occurs. GSSG can be formed ex vivo if samples are not processed quickly in cold, acidic conditions. Even small delays can shift the apparent ratio, making standardized protocols essential.
Enzymatic recycling assays measure total glutathione, while HPLC and LC-MS/MS can resolve GSH and GSSG separately. Derivatization or thiol-blocking reagents are sometimes used to stabilize and detect the compounds. Method choice depends on the sample type and required specificity.
Dry glutathione powder is typically stored at -20 °C in a desiccated container protected from light. Solutions should be prepared fresh, kept acidic or frozen, and avoid repeated freeze-thaw cycles. Stability should be confirmed for each specific laboratory condition.
Pre-analytical handling, extraction chemistry, and detection method all influence reported glutathione values. Oxidation during sample processing can shift the measured GSH/GSSG ratio. Standardized protocols and reference materials help reduce, but do not eliminate, these differences.